here it is again but in b
NSFW Tumblr
find here it is again but in b on porn pin board
here it is again but in b clips
“Are you still there? What are you waiting for? This is what you wanted, isn’t it? Well here I am, your big sister, waiting for you to do what you want to me. I’ll close my eyes again, but if nothing happens in 30 seconds, you’ve
Here is my first attempt at making yaoi! Next time there will definitely be more action going on, but for now its just Naruto being naked. This is also a Work In Progress (WIP) so expect to see it again in the near future, except better! Also, this
xxx tumblr
Via: http://altporn.net/news/2015/12/21/sexy-anna-beth-makes-it-hot-in-here/I said Anna Beth was a devil girl for Halloween in my post Devil Girl Anna Beth Blows Big Dick Jake. But now is is Xmas time and I see Anna Beth again and she is a devil girl
lucky-33: May 2015 Venice Beach Just recently sent a new set in to MS, but they didn’t use them. Here’s one of my favorite shots. So glad it is Summer again. We need to get back to the beach!
mrsrobinatwood: I saw this wonderful set a little while ago, but it seemed out of order, so here it is again and hopefully in a story sequence. It is so good, I just imagine being one of the, tied and lead to the gallows. They place us over our trapdoors
I’m working on a webcomic ^_^ The story has few years but I drew the first chapter last summer. I want to submit it so I’m drawing it again, this is a comparison xD Sorry but the webcomic is only in spanish here! http://risengeist.subcultur
Raging Stallion - The Drifter
nosmir: Took a while to finish this due to aforementioned babysitting hell, but here it is!@urtheart Once again bangin’ my gals. SHE GETS AROUND, DOESN’T SHE.Though as per usual, it’s in a mutually enjoyable scenario (my favorite kind) and one
ry-spirit: Sorry we’re Closed. I think this artwork became quite viral on the internet after I posted it on Deviantart. But since I wasn’t around Tumblr or Myspace or Twitter, I didn’t know what was going on in the scene, anyway here it is again.
momfacials: incexxx2: “Mo-o-om, can you come in here for a second?- What’s up baby? Oh, having some fun again, are you?- Yeah but… I can’t… you know!- That’s what happens when you overdo it. Is that your fifth time for today?- Yeah but
By fan request, here are some very busty girls. I put in a picture of Tsunade so people will be satisfised since Naruto Hentai seems to be a popular request. The last one I do believe I’ve posted before, but damn is it too good to pass up again.
This is the last post in the “Where’s Peri” arc. Click here to read it from the beginning!
figgotry: burgerkiss: Shit i pressed wrong button again i was goin to answer in public, soo here it is I searched the word “least favorite”, and the translation came with “Most Favorite” (just to make sure) But then i search the “least favorite”
Someone tried submitting from UCSC last night but the image attached is broken. Send in your submission again. There are also a few e-mail submits that were sent in without any campus ID. I replied to a few but I’ll post it here again. Retake the
nomnomnom
hiatus
stacy42g: I posted this a long time ago but haven’t seen it re-blogged in awhile. It was over 2,000 likes that’s a record for me. So here it is again. Hope you like it. Stacy42G
underweartuesday: I know that I am quite late this week, but I really wanted to get this one in. I’m traveling for work once again this week, and it is far colder here than it is at home. I liked the outerwear theme, as I definitely didn’t pack
stephanie-mason-my-hotwife: Did I post this one already? I don’t think so. But if I did, here it is again. Hotwife Lydia Luxy flashing some titties at the gas station
shonuff44: A. Nelson Comm Leg-Locking with Felicia 2 Not sure what this leg lock is called, but it looks pretty painful. Here is Felicia, once again in a tight embrace with the great Jon Talbain. I think she is amping up for if Capcom ever releases
rybsfm: I said ‘soon,’ right? Because here it is, that Bhadra commission. This is two layers of Too Hot for Tumblr; How ‘bout that? Shush It’s not perfect in my eyes, but then again I’m sure nothing ever will be~.
atthefrozenhorizon: kinkyspree: Plan B My sides are gone. XD *gigglefits* Second time I’ve seen this, still just as great. Don’t remember if I reblogged it before, but just in case, here it is again. X3
sapphire-and-greyzeek: Mini Grey is back! I really didn’t expect such a response, but it’s pretty clear.So here we go again. This time in a completely seperate blog, like I should’ve done it the first time.To get to the blog, click the image above
pandanoi: Then again, this is not what I should be doing x___D Adult versions of Jean, Eren and Armin ♥ I imagined that Eren would wear bite marks around his hands and arms, I know those should heal and all, but I liked to think he had to do that so
They’re airing The Pianist here today. I’ve seen it once already, but nothing in this world is going to stop me from watching it again, because it was simply that good the last time. I bet everyone’s rolling their eyes as they’re
mariocrashfan110: Here is a small sneak peak for the Adventure Time Episode “Princess Day”. Things are getting crazy with LSP. What’s awesome is that we get to see Flame Princess again, but probably not as a big role in here. But it’s good to
itsazachontitan: I had posted this before, but I forgot to tag it and now it’s lost in the void so here it is again
rjay7809: Someone had stolen this vid from me nd tumblr took it down but here it is again, sexy latin stud sharing his dick in public
nosmir: Took a while to finish this due to aforementioned babysitting hell, but here it is! @urtheart Once again bangin’ my gals. SHE GETS AROUND, DOESN’T SHE. Though as per usual, it’s in a mutually enjoyable scenario (my favorite kind) and one
grimphantom2: shonuff44: A. Nelson Comm Leg-Locking with Felicia 2 Not sure what this leg lock is called, but it looks pretty painful. Here is Felicia, once again in a tight embrace with the great Jon Talbain. I think she is amping up for if Capcom
whoreneegirl: Oh boy. I’m writhing on my plug now. Here are a few pictures where I’m lubing it up in my mouth, then my pussy and then once I crammed it in and not it sits. I don’t know why my holes got so small again, but it is hard to relax, the
yukined: 世界のジン多摩クッキングショー! Hijikata’s dream show.
Tatiana Maslany as Simon Pegg in ‘Shaun of the Dead’ The Hollywood Reporter helped Tatiana Maslany step into Simon Pegg’s “Shaun of the Dead” shoes, as part of their Titans of Comic-Con photo series. But click here for video and an interview
momentI’ll smile for a moment. While I let your words dance in my headLet me romanticize as if they were meaningful. But just for a moment. Because I know it’s too good to be true. Thank you.Gone is that moment and here I am again.
deathbyspookyopen: Dean opens the conversation with “Cas, you okay?” Contrast that to the way that he withdraws from the conversation when Sam is in the car too. It’s been talked about over and over and over again, but here is yet another example
seto-gin: I got the recipe from HERE. Sorry for the page being Japanese and the measurements are in grams… Long time no post…Again.Life is a little busy right now for me, but it’s slowing down again so I can do fun stuff like this ↓ The cookie
beetimestwo: princelesscomic: isaisanisa: the importance of representation in media I think I reblogged this before but…who cares. Here it is again! the original teen titans will always be the best
erickhans: melbiexxz: xdavisd: This week has been really crazy, i found another girl for quick sex from here again. She has a boyfriend, but want some new dicks. I fuck her in my room. She is not so pretty, but yeah we really enjoy it, what a week haha.
female-destruction: Stay still, fucking slut! Your tight little asshole is mine now, get used to it. Maybe your boyfriend will think twice before leaving you home alone again, but just in case he doesn’t, know this: I will be here, every day, pumping
youdidnotseeme: Okkkk, finally. Here is a Kurloz in nothing but heels and snake. All this nudity is making me have to really research BODIES. It’s like having homework all over again.
betocheto17: rjay7809:Someone had stolen this vid from me nd tumblr took it down but here it is again, sexy latin stud sharing his dick in public Follow betocheto17 for more 🔥 content!
tardisandfeathered: dream-yourself-free: I reblog this every time it comes up on my dashboard, not because it is a “rule” but because every time I see it the love and sincerity on her face hit me all over again and I think everyone deserves to see
zankyger: titenoute: I case someone want to experiment what real terror is go here it’s in english. WHY WOULD YOU SOURCE THAT.
Today is my 23rd birthday I’m blessed n unstressed. I’m in PR just chilling smoking my life away lol. Need more weed but I’ll get it tomorrow lol. But anyways I’m happy I’m out here I’m upset it’s raining on my day but then again I need
ten-loved-cookies: Trying to understand Ten’s face: 4x02 (The Fires of Pompeii)
curveappeal: I think this is my 3rd submission so hello again! I love love love this outfit, and since it’s been unseasonably warm here in upstate NY, I am rocking it until the cold weather kicks in! I wear that v-neck entirely too much but it’s
voidrucas: mccullou29: nobleseraphim: gethenian: boltonsrepairshop: IS THAT A GIF IN A GIF IN A GIF This is officially the best thing on tumblr. Wtf I forgot about this and here it is again. Now i will have it forever. i have never seen this but
zestful-flesh: I’m coming home, it’s late again, I’m high as I’ve ever been You’re sitting up, you’re in our bed - crying for a ghost again. No room could be as dark or as empty as ours is. ‘Cause I’m at home but I’m not here and
naoren: sentper: @naoren hath sinned in but the foulest manner, and thus IT IS TIME FOR DIVINE PUNISHMENT Here’s Dia! Again! She’s using magic this time!! KMDKMFKMGKMFKMVKMCKMCKMKNKMSENTYYYYYYYYY
delvg: “Everything clear, Aqua?”“The water is, but something just doesn’t seem right..”Im in a gemsona mood again so here’s a scene from me and jen-iii ‘s gemsonas’ background.That’s all I’m saying cuz we might make a comic of it
kisunya777: FAN SU SHORT ANIMATION! So, here it is! OuO Four months of work and I finely did it! UuUThank you for your support again!!!! It was awesome QuQ
i’ve drawn it a few times! i uploaded this one in a doodle dump a while ago but here it is again 8′D
The The - Armaggeddon Days Are Here (Again) . This song is brilliant, in case you’ve never heard it. As relevant as ever, even more than two decades after it was written. Not anti-God but anti-religion. Religion is a pair of blinders when worn by
nikkipet: You wanted to create a place where you and your people would never be vulnerable again. This wasn’t part of the things I had planned but here it is anyway. I need to sit down and rethink my life choices. Never start getting ideas in the
